East Valley Family Medical

Physician Practice

Practice Overview

Practice NameEast Valley Family Medical
Websiteeastvalleyfamilypractice.com
Number of Physicians (MD/DO)20
Number of Locations1
About the Practice

East Valley Family Practice specializes in Family Medicine, providing comprehensive clinical services for individuals and families. Their services include General Medicine, covering complete physicals, chronic disease management for conditions like Diabetes, Hypertension, and Osteoporosis, immunizations, sports and employment physicals, consultations/referrals, and minor procedures. They also offer Pediatric Care, including well and sick child visits, immunizations, and developmental care, as well as Women's Health services such as Pap testing, breast exams, mammograms, bone density checks, and birth control services.

Practice Locations (1)

3885 S Val Vista Drive, #103, Gilbert AZ 85297

Our Physicians (21)

Specialties
Family Medicine

17 physicians

Internal Medicine

4 physicians

All Physicians
Loading physicians...

Loading physician information...

Leadership Team

Sunita Gupta

Medical Doctor

Miguel Chavarin

Office Manager

Nicole Walker

Billing Manager

Electronic Health Record System

Unknown

Primary Electronic Health Record System

Research Analysis
Methodology & Findings

Based on the information gathered from the Google searches, it is not possible to definitively determine the patient portal vendor used specifically by East Valley Family Practice (eastvalleyfamilypractice.com). While searches for patient portals in the "East Valley" area yielded results for several different medical practices, including East Valley Primary Care Physicians, East Valley Community Health Center, East Valley Internal Medicine, and East Valley Naturopathic Doctors, the patient portal for East Valley Family Practice at the domain eastvalleyfamilypractice.com was not explicitly identified by name or vendor in the search results. Other East Valley practices were found to use specific patient portals: * East Valley Internal Medicine utilizes the E-Clinicalworks patient portal. * East Valley Community Health Center uses the InteliChart Patient Portal. * East Valley Naturopathic Doctors use the Patient Fusion portal, which is part of Practice Fusion. However, no such specific information was found for East Valley Family Practice (eastvalleyfamilypractice.com) in the provided search results.